General Information

  • ID:  hor004141
  • Uniprot ID:  Q8CE23(80-122)
  • Protein name:  QRF-amide
  • Gene name:  QRFP
  • Organism:  Mus musculus (Mouse)
  • Family:  RFamide neuropeptide family
  • Source:  animal
  • Expression:  Expressed in the brain with highest levels in the periventricular hypothalamic nucleus and lateral hypothalamic areas. Expressed at moderate levels in the adrenal gland, eye, heart, intestine, liver, lung, kidney, mesenteric lymph node, ovary, placenta, P
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding; GO:0005184 neuropeptide hormone activity; GO:0031854 orexigenic neuropeptide QRFP receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007625 grooming behavior; GO:0007626 locomotory behavior; GO:0045777 positive regulation of blood pressure; GO:0060259 regulation of feeding behavior
  • GO CC:  GO:0005575 cellular_component; GO:0005576 extracellular region

Sequence Information

  • Sequence:  QDGSSEAAGFLPADSEKASGPLGTLAEELSSYSRRKGGFSFRF
  • Length:  43(80-122)
  • Propeptide:  MRGFRPLLSLLLPLSACFPLLDRRGPTDIGDIGARMNWAQLAEGHPPNSVQNPQPQALLVVAREQQASHREHTGFRLGRQDGSSEAAGFLPADSEKASGPLGTLAEELSSYSRRKGGFSFRFGR
  • Signal peptide:  MRGFRPLLSLLLPLSAC
  • Modification:  T43 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates feeding and grooming behavior, metabolic rate and locomotor activity and increases blood pressure. May have orexigenic activity. May promote aldosterone secretion by the adrenal gland.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Qrfpr
  • Target Unid:  P83861
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q8CE23-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004141_AF2.pdbhor004141_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 526118 Formula: C197H301N55O67
Absent amino acids: CHIMNVW Common amino acids: S
pI: 4.77 Basic residues: 5
Polar residues: 16 Hydrophobic residues: 13
Hydrophobicity: -56.74 Boman Index: -8970
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 47.91
Instability Index: 6792.79 Extinction Coefficient cystines: 1490
Absorbance 280nm: 35.48

Literature

  • PubMed ID:  12960173
  • Title:  A New Peptidic Ligand and Its Receptor Regulating Adrenal Function in Rats.